PDB entry 1g7b

View 1g7b on RCSB PDB site
Description: 1.3 a structure of t3r3 human insulin at 100 k
Class: hormone/growth factor
Keywords: T3R3 Human Insulin Hexamer, hormone-growth factor COMPLEX
Deposited on 2000-11-09, released 2001-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.176
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin a-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.04: d1g7b.1
• Chain 'B':
  Compound: insulin b-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.04: d1g7b.1
• Chain 'C':
  Compound: insulin a-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.04: d1g7b.2
• Chain 'D':
  Compound: insulin b-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.04: d1g7b.2
• Chain 'E':
  Compound: insulin a-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.04: d1g7b.3
• Chain 'F':
  Compound: insulin b-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.04: d1g7b.3
• Chain 'G':
  Compound: insulin a-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.04: d1g7b.4
• Chain 'H':
  Compound: insulin b-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308
  Domains in SCOPe 2.04: d1g7b.4
• Heterogens: ZN, CL, GOL, ACN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7bA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7bB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7bC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >1g7bD (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1g7bD (D:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7bE (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7bF (F:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7bG (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >1g7bH (H:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1g7bH (H:)
  vnqhlcgshlvealylvcgergffytpk