PDB entry 1fza

View 1fza on RCSB PDB site
Description: crystal structure of fibrinogen fragment d
Class: blood coagulation
Keywords: blood coagulation, plasma, platelet, fibrinogen, fibrin
Deposited on 1997-08-05, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.263
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzaa_
  • Chain 'B':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzab1, d1fzab2
  • Chain 'C':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02679 (0-End)
      • conflict (0)
    Domains in SCOPe 2.07: d1fzac1, d1fzac2
  • Chain 'D':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzad_
  • Chain 'E':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzae1, d1fzae2
  • Chain 'F':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02679 (0-End)
      • conflict (0)
    Domains in SCOPe 2.07: d1fzaf1, d1fzaf2
  • Heterogens: NAG, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fzaA (A:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzaA (A:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fzaB (B:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzaB (B:)
    khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvs
    gkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwd
    pykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyg
    gftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlt
    sdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysm
    rkmsmkirpffpq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fzaC (C:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzaC (C:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltige
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fzaD (D:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzaD (D:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fzaE (E:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzaE (E:)
    khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvs
    gkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwd
    pykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyg
    gftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlt
    sdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysm
    rkmsmkirpffpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fzaF (F:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzaF (F:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltige