PDB entry 1fx8

View 1fx8 on RCSB PDB site
Description: crystal structure of the e. coli glycerol facilitator (glpf) with substrate glycerol
Class: membrane protein
Keywords: glycerol-conducting membrane channel protein, MEMBRANE PROTEIN
Deposited on 2000-09-25, released 2000-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol uptake facilitator protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fx8a_
  • Heterogens: BOG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fx8A (A:)
    msqtstlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiylta
    gvsgahlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthh
    ivrgsvesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplap
    lliglliavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgp
    ivgaivgafayrkligrhlpcdicvveeketttpseqkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx8A (A:)
    tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga
    hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
    vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
    liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
    vgafayrkligrhl