PDB entry 1frp

View 1frp on RCSB PDB site
Description: crystal structure of fructose-1,6-bisphosphatase complexed with fructose-2,6-bisphosphate, amp and zn2+ at 2.0 angstroms resolution. aspects of synergism between inhibitors
Class: hydrolase(phosphoric monoester)
Keywords: hydrolase(phosphoric monoester)
Deposited on 1994-08-26, released 1994-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose 1,6-bisphosphatase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00636 (Start-334)
      • conflict (19)
      • conflict (61)
      • conflict (95)
      • conflict (198)
    Domains in SCOPe 2.07: d1frpa_
  • Chain 'B':
    Compound: fructose 1,6-bisphosphatase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00636 (Start-334)
      • conflict (19)
      • conflict (61)
      • conflict (95)
      • conflict (198)
    Domains in SCOPe 2.07: d1frpb_
  • Heterogens: FDP, ZN, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1frpA (A:)
    tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
    gatnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1frpA (A:)
    nivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygiagatvkkld
    vlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpldgssnidclvsigt
    ifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpaigefi
    lvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmvadvhr
    tlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptdihqra
    piilgspedvtelleiyqkha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1frpB (B:)
    tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
    gatnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1frpB (B:)
    nivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygiagatvkkld
    vlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpldgssnidclvsigt
    ifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpaigefi
    lvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmvadvhr
    tlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptdihqra
    piilgspedvtelleiyqkha