PDB entry 1fp0

View 1fp0 on RCSB PDB site
Description: solution structure of the phd domain from the kap-1 corepressor
Class: transcription
Keywords: PHD domain, C3HC4 type zinc binding domain, NMR-structure, TRANSCRIPTION
Deposited on 2000-08-29, released 2001-01-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: kap-1 corepressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13263 (18-78)
    • expression tag (0-17)
    • cloning artifact (79-87)
  Domains in SCOPe 2.03: d1fp0a1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fp0A (A:)
  mrgshhhhhhgsdiidefgtlddsaticrvcqkpgdlvmcnqcefcfhldchlpalqdvp
  geewscslchvlpdlkeedvdlqackln