PDB entry 1fh3

View 1fh3 on RCSB PDB site
Description: nmr structures of lqh III alpha-like scorpion toxin from leiurus quinquestriatus corresponding to the major conformer in solution
Class: toxin
Keywords: alpha-like toxin, scorpion toxin, sodium channel inhibitor non-proline cis peptide bond, cis-trans isomerism
Deposited on 2000-07-31, released 2000-08-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lqh III alpha-like toxin
  Species: Leiurus quinquestriatus hebraeus [TaxId:6884]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56678 (0-66)
  Domains in SCOPe 2.04: d1fh3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fh3A (A:)
  vrdgyiaqpencvyhcfpgssgcdtlckekggtsghcgfkvghglacwcnalpdnvgiiv
  egekchs