PDB entry 1fgb

View 1fgb on RCSB PDB site
Description: toxin
Class: enterotoxin
Keywords: cholera toxin, choleragenoid, enterotoxin, ADP-ribosylation
Deposited on 1996-02-21, released 1996-12-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin b subunit pentamer
  Species: Vibrio cholerae [TaxId:44104]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • conflict (46)
  Domains in SCOPe 2.03: d1fgbd_
• Chain 'E':
  Compound: cholera toxin b subunit pentamer
  Species: Vibrio cholerae [TaxId:44104]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • conflict (46)
  Domains in SCOPe 2.03: d1fgbe_
• Chain 'F':
  Compound: cholera toxin b subunit pentamer
  Species: Vibrio cholerae [TaxId:44104]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • conflict (46)
  Domains in SCOPe 2.03: d1fgbf_
• Chain 'G':
  Compound: cholera toxin b subunit pentamer
  Species: Vibrio cholerae [TaxId:44104]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • conflict (46)
  Domains in SCOPe 2.03: d1fgbg_
• Chain 'H':
  Compound: cholera toxin b subunit pentamer
  Species: Vibrio cholerae [TaxId:44104]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • conflict (46)
  Domains in SCOPe 2.03: d1fgbh_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fgbD (D:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fgbE (E:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fgbF (F:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fgbG (G:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fgbH (H:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman