PDB entry 1f36

View 1f36 on RCSB PDB site
Description: the crystal structure of fis mutant k36e reveals that the transactivation region of the fis protein contains extended mobile beta-hairpin arms
Class: transactivation region
Keywords: transactivation region, DNA-binding protein, protein-protein interaction domain
Deposited on 1997-06-20, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.222
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fis
    Species: Escherichia coli [TaxId:562]
    Gene: FIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6R3 (Start-97)
      • engineered (35)
    Domains in SCOPe 2.07: d1f36a_
  • Chain 'B':
    Compound: fis
    Species: Escherichia coli [TaxId:562]
    Gene: FIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6R3 (Start-97)
      • engineered (35)
    Domains in SCOPe 2.07: d1f36b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f36A (A:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalenyfaqlngqdvndlyelvlaeveq
    plldmvmqytrgnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f36A (A:)
    vltvstvnsqdqvtqkplrdsvkqalenyfaqlngqdvndlyelvlaeveqplldmvmqy
    trgnqtraalmmginrgtlrkklkkygmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f36B (B:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalenyfaqlngqdvndlyelvlaeveq
    plldmvmqytrgnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f36B (B:)
    vltvstvnsqdqvtqkplrdsvkqalenyfaqlngqdvndlyelvlaeveqplldmvmqy
    trgnqtraalmmginrgtlrkklkkygmn