PDB entry 1f2s
View 1f2s on RCSB PDB site
Description: crystal structure of the complex formed between bovine beta-trypsin and mcti-a, a trypsin inhibitor of squash family at 1.8 a resolution
Class: hydrolase/hydrolase inhibitor
Keywords: proteinase-inhibitor complex, trypsin, hydrolase-hydrolase inhibitor complex
Deposited on
2000-05-29, released
2000-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-04, with a file datestamp of
2017-09-29.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: Trypsin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1f2se_ - Chain 'I':
Compound: trypsin inhibitor a
Species: Momordica charantia [TaxId:3673]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1f2si_ - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1f2sE (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>1f2sI (I:)
ricpriwmeckrdsdcmaecicvmghcg