PDB entry 1f2s

View 1f2s on RCSB PDB site
Description: crystal structure of the complex formed between bovine beta-trypsin and mcti-a, a trypsin inhibitor of squash family at 1.8 a resolution
Class: hydrolase/hydrolase inhibitor
Keywords: proteinase-inhibitor complex, trypsin, hydrolase-hydrolase inhibitor complex
Deposited on 2000-05-29, released 2000-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f2se_
  • Chain 'I':
    Compound: trypsin inhibitor a
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10295 (0-27)
      • conflict (23)
    Domains in SCOPe 2.07: d1f2si_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f2sE (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f2sI (I:)
ricpriwmeckrdsdcmaecicvmghcg