PDB entry 1ewo

View 1ewo on RCSB PDB site
Description: the cysteine protease cruzain bound to wrr-204
Class: hydrolase/hydrolase inhibitor
Keywords: cysteine protease, drug design, covalent inhibitor, cruzipain, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-04-26, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cruzain
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewoa_
  • Heterogens: VSC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewoA (A:)
    apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
    sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
    deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
    knswttqwgeegyiriakgsnqclvkeeassavvg