PDB entry 1euu

View 1euu on RCSB PDB site
Description: sialidase or neuraminidase, large 68kd form
Class: hydrolase
Keywords: hydrolase, glycosidase
Deposited on 1996-06-21, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: MICROMONOSPORA VIRIDIFACIENS [TaxId:1881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1euua1, d1euua2, d1euua3
  • Heterogens: GAL, NA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1euuA (A:)
    vppggeplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqr
    rstdggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgt
    dpadpnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrli
    qqytiinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsg
    yrkvavstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsr
    sqgtirmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg
    gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
    akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetare
    dgrasnvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvad
    yeiytslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaele
    vegqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euuA (A:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r