PDB entry 1ema

View 1ema on RCSB PDB site
Description: green fluorescent protein from aequorea victoria
Class: fluorescent protein
Keywords: beta-barrel, autocatalytic, fluorophore, bioluminescense fluorescent protein
Deposited on 1996-08-01, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (1-End)
      • chromophore (65)
    Domains in SCOPe 2.07: d1emaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1emaA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emaA (A:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi