PDB entry 1ek0

View 1ek0 on RCSB PDB site
Description: gppnhp-bound ypt51 at 1.48 a resolution
Class: endocytosis/exocytosis
Keywords: g protein, vesicular traffic, GTP hydrolysis, ypt/rab protein, endocytosis, hydrolase, endocytosis-exocytosis complex
Deposited on 2000-03-06, released 2000-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GTP-binding protein ypt51)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36017 (0-169)
      • modified residue (70)
      • modified residue (119)
    Domains in SCOPe 2.08: d1ek0a_
  • Heterogens: MG, NI, GNP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ek0A (A:)
vtsiklvllgeaavgkssivlrfvsndfaenkeptigaafltqrvtinehtvkfeiwdta
gqerfaslapmyyrnaqaalvvydvtkpqsfikarhwvkelheqaskdiiialvgnkidm
lqeggerkvareegeklaeekgllffetsaktgenvndvflgigekiplk