PDB entry 1ej7

View 1ej7 on RCSB PDB site
Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions
Class: lyase
Keywords: TIM Barrel, alpha/beta barrel, LYASE
Deposited on 2000-03-01, released 2000-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.149
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: rubisco (large subunit)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00876
      • conflict (16)
      • conflict (374)
    Domains in SCOPe 2.07: d1ej7l1, d1ej7l2
  • Chain 'S':
    Compound: rubisco (small subunit)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej7s_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ej7L (L:)
    pqtetkasvgfkagvkdykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaess
    tgtwttvwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivg
    nvfgfkalralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsa
    knygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylna
    tagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavid
    rqknhgihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgi
    yftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrv
    aleacvkarnegrdlaqegneiireackwspelaaacevwkeivfnfaavdvldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej7L (L:)
    kdykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsl
    drykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrled
    lrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggl
    dftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfa
    relgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlaka
    lrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpv
    asggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdl
    aqegneiireackwspelaaacevwkeivfnfaavdv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej7S (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
    egy