PDB entry 1efu

View 1efu on RCSB PDB site
Description: elongation factor complex ef-tu/ef-ts from escherichia coli
Class: complex (two elongation factors)
Keywords: elongation factor, complex (two elongation factors)
Deposited on 1996-07-09, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.175
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efua1, d1efua2, d1efua3
  • Chain 'B':
    Compound: elongation factor ts
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efub2, d1efub3, d1efub4
  • Chain 'C':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efuc1, d1efuc2, d1efuc3
  • Chain 'D':
    Compound: elongation factor ts
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efud2, d1efud3, d1efud4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efuA (A:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efuA (A:)
    kphvnvgtighvdhgkttltaaittvlaktyggatshveydtptrhyahvdcpghadyvk
    nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
    emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeperaidkp
    fllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrklldegr
    agenvgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtpffkgyrpq
    fyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggrtvgagvva
    kvls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efuB (B:)
    aeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgv
    iktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerva
    lvakigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefi
    kpedvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepskt
    vgqllkehnaevtgfirfevgegiekvetdfaaevaamskqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1efuC (C:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efuC (C:)
    kphvnvgtighvdhgkttltaaittvlaktyggatshveydtptrhyahvdcpghadyvk
    nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
    emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeperaidkp
    fllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrklldegr
    agenvgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtpffkgyrpq
    fyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggrtvgagvva
    kvls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efuD (D:)
    aeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgv
    iktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerva
    lvakigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefi
    kpedvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepskt
    vgqllkehnaevtgfirfevgegiekvetdfaaevaamskqs