PDB entry 1eci

View 1eci on RCSB PDB site
Description: ectatomin (water solution, nmr 20 structures)
Class: toxin
Keywords: pore-forming toxins, ant venoms
Deposited on 1995-08-16, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ectatomin
  Species: Ectatomma tuberculatum [TaxId:39300]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49343 (0-36)
  Domains in SCOPe 2.08: d1ecia_
• Chain 'B':
  Compound: ectatomin
  Species: Ectatomma tuberculatum [TaxId:39300]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49344 (0-33)
  Domains in SCOPe 2.08: d1ecib_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eciA (A:)
  gvipkkiwetvcptvepwakkcsgdiatyikrecgkl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eciB (B:)
  wstivklticptlksmakkcegsiatmikkkcdk