PDB entry 1drm

View 1drm on RCSB PDB site
Description: crystal structure of the ligand free bjfixl heme domain
Deposited on 2000-01-06, released 2000-01-24
The last revision prior to the SCOP 1.57 freeze date was dated 2000-01-24, with a file datestamp of 2000-01-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1drma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1drmA (A:)
ipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtts
dphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq