PDB entry 1di3

View 1di3 on RCSB PDB site
Description: role of amino acid residues at turns in the conformational stability and folding of human lysozyme
Class: hydrolase
Keywords: stability, turn, mutant, hydrolase
Deposited on 1999-11-28, released 1999-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (49)
    Domains in SCOPe 2.08: d1di3a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1di3A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdgstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv