PDB entry 1cxu

View 1cxu on RCSB PDB site
Description: 1.42a resolution asv integrase core domain from citrate
Deposited on 1999-08-30, released 1999-09-08
The last revision prior to the SCOP 1.57 freeze date was dated 2000-04-02, with a file datestamp of 2000-04-02.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.187
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cxua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cxuA (A:)
gplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlgrp
kaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegdg
fmkriptskqgellakamyalnh