PDB entry 1cot

View 1cot on RCSB PDB site
Description: x-ray structure of the cytochrome c2 isolated from paracoccus denitrificans refined to 1.7 angstroms resolution
Deposited on 1994-07-06, released 1994-09-30
The last revision prior to the SCOP 1.57 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1cot__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cot_ (-)
    dgdaakgekefnkckachmiqapdgtdiikggktgpnlygvvgrkiaseegfkygegile
    vaeknpdltwteadlieyvtdpkpwlvkmtddkgaktkmtfkmgknqadvvaflaqnspd
    a