PDB entry 1cok

View 1cok on RCSB PDB site
Description: structure of the c-terminal domain of p73
Class: gene regulation
Keywords: p73 sam-like domain, gene regulation
Deposited on 1999-05-28, released 1999-08-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (second splice variant p73)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1coka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cokA (A:)
    yhadpslvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglq
    dlkqghdy