PDB entry 1chp
View 1chp on RCSB PDB site
Description: surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Class: toxin
Keywords: toxin
Deposited on
1995-02-15, released
1996-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'D':
Compound: cholera toxin b pentamer
Species: Vibrio cholerae [TaxId:666]
Database cross-references and differences (RAF-indexed):
- Uniprot P01556 (0-102)
- conflict (17)
- engineered (32)
- conflict (46)
Domains in SCOPe 2.04: d1chpd_ - Chain 'E':
Compound: cholera toxin b pentamer
Species: Vibrio cholerae [TaxId:666]
Database cross-references and differences (RAF-indexed):
- Uniprot P01556 (0-102)
- conflict (17)
- engineered (32)
- conflict (46)
Domains in SCOPe 2.04: d1chpe_ - Chain 'F':
Compound: cholera toxin b pentamer
Species: Vibrio cholerae [TaxId:666]
Database cross-references and differences (RAF-indexed):
- Uniprot P01556 (0-102)
- conflict (17)
- engineered (32)
- conflict (46)
Domains in SCOPe 2.04: d1chpf_ - Chain 'G':
Compound: cholera toxin b pentamer
Species: Vibrio cholerae [TaxId:666]
Database cross-references and differences (RAF-indexed):
- Uniprot P01556 (0-102)
- conflict (17)
- engineered (32)
- conflict (46)
Domains in SCOPe 2.04: d1chpg_ - Chain 'H':
Compound: cholera toxin b pentamer
Species: Vibrio cholerae [TaxId:666]
Database cross-references and differences (RAF-indexed):
- Uniprot P01556 (0-102)
- conflict (17)
- engineered (32)
- conflict (46)
Domains in SCOPe 2.04: d1chph_ - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1chpD (D:)
tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1chpE (E:)
tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1chpF (F:)
tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>1chpG (G:)
tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1chpH (H:)
tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman