PDB entry 1cgo

View 1cgo on RCSB PDB site
Description: cytochrome c'
Deposited on 1995-05-01, released 1995-07-31
The last revision prior to the SCOP 1.57 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1cgo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cgo_ (-)
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktltalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrk