PDB entry 1ced

View 1ced on RCSB PDB site
Description: the structure of cytochrome c6 from monoraphidium braunii, nmr, minimized average structure
Deposited on 1996-03-06, released 1996-08-17
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ced__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ced_ (-)
  eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
  mpawdgrldedeiagvaayvydqaagnkw