PDB entry 1bu3

View 1bu3 on RCSB PDB site
Description: refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.
Class: calcium binding
Keywords: calcium binding
Deposited on 1998-08-30, released 1999-08-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.214
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calcium-binding protein
  Species: Merluccius bilinearis [TaxId:79698]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56503 (0-107)
  Domains in SCOPe 2.03: d1bu3a_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bu3A (A:)
  afsgiladadvaaalkaceaadsfnykaffakvgltaksaddikkaffvidqdksgfiee
  delklflqvfsagaraltdaetkaflkagdsdgdgaigvdewaalvka