PDB entry 1bpo

View 1bpo on RCSB PDB site
Description: clathrin heavy-chain terminal domain and linker
Class: membrane protein
Keywords: clathrin endocytosis beta-propeller coated-pits, membrane protein
Deposited on 1998-08-11, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (clathrin)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpoa1, d1bpoa2
  • Chain 'B':
    Compound: protein (clathrin)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpob1, d1bpob2
  • Chain 'C':
    Compound: protein (clathrin)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpoc1, d1bpoc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bpoA (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpoA (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bpoB (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpoB (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bpoC (C:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpoC (C:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnk