PDB entry 1boz

View 1boz on RCSB PDB site
Description: structure-based design and synthesis of lipophilic 2,4-diamino-6-substituted quinazolines and their evaluation as inhibitors of dihydrofolate reductase and potential antitumor agents
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1998-08-06, released 1998-08-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (dihydrofolate reductase)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00374 (0-185)
    • sequence conflict (30)
  Domains in SCOPe 2.03: d1boza_
• Heterogens: NDP, PRD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bozA (A:)
  vgslncivavsqnmgigkngdlpwpplrnegryfqrmtttssvegkqnlvimgkktwfsi
  peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
  ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
  vyeknd