PDB entry 1blj

View 1blj on RCSB PDB site
Description: nmr ensemble of blk sh2 domain, 20 structures
Class: phosphorylation
Keywords: signal transduction, tyrosine kinase, transferase, phosphotransferase, phosphorylation
Deposited on 1996-03-26, released 1997-03-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: p55 blk protein tyrosine kinase
  Species: Mus musculus [TaxId:10090]
  Gene: P55 BLK KINASE (RESIDUES 107 -
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16277 (0-113)
    • conflict (0)
  Domains in SCOPe 2.04: d1blja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bljA (A:)
  gsvapvetlevekwffrtisrkdaerqllapmnkagsfliresesnkgafslsvkdittq
  gevvkhykirsldnggyyispritfptlqalvqhyskkgdglcqkltlpcvnla