PDB entry 1bl0

View 1bl0 on RCSB PDB site
Description: multiple antibiotic resistance protein (mara)/DNA complex
Class: transcription/DNA
Keywords: transcriptional activator; a bipartite helix-turn-helix protein, transcription/DNA complex
Deposited on 1998-07-22, released 1998-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (multiple antibiotic resistance protein)
    Species: Escherichia coli [TaxId:562]
    Gene: MARA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bl0a1, d1bl0a2
  • Chain 'B':
    Compound: DNA (5'-d(*gp*gp*gp*gp*ap*tp*tp*tp*ap*gp*cp*ap*ap*ap*ap*cp*gp*tp*gp*gp*cp*ap* tp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*cp*gp*ap*tp*gp*cp*cp*ap*cp*gp*tp*tp*tp*tp*gp*cp*tp*ap*ap*ap*tp* cp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bl0A (A:)
    mtmsrrntdaitihsildwiednlesplslekvsersgyskwhlqrmfkketghslgqyi
    rsrkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrf
    lhplnhyns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bl0A (A:)
    daitihsildwiednlesplslekvsersgyskwhlqrmfkketghslgqyirsrkmtei
    aqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrflhpl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.