PDB entry 1b9u

View 1b9u on RCSB PDB site
Description: membrane domain of the subunit b of the e.coli ATP synthase
Class: hydrolase
Keywords: ATP synthase, membrane protein, hydrolase
Deposited on 1999-02-15, released 1999-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ATP synthase)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9uA (A:)
    mnlnatilgqaiafvlfvlfcmkyvwpplmaaie