PDB entry 1awx

View 1awx on RCSB PDB site
Description: sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure
Class: transferase
Keywords: tyrosine kinase, x-linked agammaglobulinemia, xla, btk, sh3 domain, transferase
Deposited on 1997-10-06, released 1998-04-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bruton's tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1awxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1awxA (A:)
gsmstselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsny
vteaeds