PDB entry 1avy

View 1avy on RCSB PDB site
Description: fibritin deletion mutant m (bacteriophage t4)
Deposited on 1997-09-22, released 1997-12-03
The last revision prior to the SCOP 1.63 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.22
AEROSPACI score: -1.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1avya_
  • Chain 'B':
    Domains in SCOP 1.63: d1avyb_
  • Chain 'C':
    Domains in SCOP 1.63: d1avyc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1avyA (A:)
tnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvl
lstflspa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1avyB (B:)
vrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvllstflsp

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1avyC (C:)
ltnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewv
llstflsp