PDB entry 1al3

View 1al3 on RCSB PDB site
Description: cofactor binding fragment of cysb from klebsiella aerogenes
Class: transcription regulation
Keywords: lysr family, cysteine biosynthesis, transcription regulation
Deposited on 1997-06-10, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cys regulon transcriptional activator cysb
    Species: Klebsiella aerogenes [TaxId:28451]
    Gene: CYSB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1al3a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1al3A (A:)
    mklqqlryivevvnhnlnvsstaeglytsqpgiskqvrmledelgiqifarsgkhltqvt
    pagqeiiriarevlskvdaiksvagehtwpdkgslyvatthtqaryalpgvikgfieryp
    rvslhmhqgsptqiaeavskgnadfaiatealhlyddlvmlpcyhwnrsivvtpehplat
    kgsvsieelaqyplvtytfgftgrseldtafnragltprivftatdadviktyvrlglgv
    gviasmavdpvsdpdlvkldangifshsttkigfrrstflrsymydfiqrfaphltrdvv
    dtavalrsnedieamfkdiklpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1al3A (A:)
    twpdkgslyvatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadfai
    atealhlyddlvmlpcyhwnrsivvtpehplatkgsvsieelaqyplvtytfgftgrsel
    dtafnragltprivftatdadviktyvrlglgvgviasmavdpvsdpdlvkldangifsh
    sttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsnedieamfkdiklpek