PDB entry 1ak0

View 1ak0 on RCSB PDB site
Description: p1 nuclease in complex with a substrate analog
Class: endonuclease
Keywords: endonuclease, p1 nuclease, reaction mechanism, thiophosphorylated oligonucleotides, glycosylated protein
Deposited on 1997-05-28, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p1 nuclease
    Species: Penicillium citrinum [TaxId:5077]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ak0a_
  • Heterogens: NAG, ZN, ADS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ak0A (A:)
    wgalghatvayvaqhyvspeaaswaqgilgsssssylasiaswadeyrltsagkwsaslh
    fidaednpptncnvdyerdcgssgcsisaianytqrvsdsslssenhaealrflvhfigd
    mtqplhdeayavggnkinvtfdgyhdnlhsdwdtympqkligghalsdaeswaktlvqni
    esgnytaqaigwikgdnisepittatrwasdanalvctvvmphgaaalqtgdlyptyyds
    vidtielqiakggyrlanwineihgseiak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ak0A (A:)
    wgalghatvayvaqhyvspeaaswaqgilgsssssylasiaswadeyrltsagkwsaslh
    fidaednpptncnvdyerdcgssgcsisaianytqrvsdsslssenhaealrflvhfigd
    mtqplhdeayavggnkinvtfdgyhdnlhsdwdtympqkligghalsdaeswaktlvqni
    esgnytaqaigwikgdnisepittatrwasdanalvctvvmphgaaalqtgdlyptyyds
    vidtielqiakggyrlanwineih