PDB entry 1ahd

View 1ahd on RCSB PDB site
Description: determination of the nmr solution structure of an antennapedia homeodomain-DNA complex
Class: DNA binding protein/DNA
Keywords: DNA binding protein/DNA
Deposited on 1993-04-02, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*gp*ap*ap*ap*gp*cp*cp*ap*tp*tp*ap*gp*ap*g)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*cp*tp*cp*tp*ap*ap*tp*gp*gp*cp*tp*tp*tp*c)-3')
  • Chain 'P':
    Compound: Antennapedia Protein Mutant
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ahdp_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ahdP (P:)
mrkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkke
nktkgepg