PDB entry 1af5

View 1af5 on RCSB PDB site
Description: group I mobile intron endonuclease
Class: endonuclease
Keywords: endonuclease, group I mobile intron, intron homing, chloroplast DNA, laglidadg motif
Deposited on 1997-03-21, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725 (0-134)
      • conflict (38)
      • engineered (52)
      • conflict (106-107)
    Domains in SCOPe 2.07: d1af5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1af5A (A:)
    kynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwflgklvdeig
    vgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkfl
    evctwvdqiaalnds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1af5A (A:)
    kynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwflgklvdeig
    vgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlplevctwvdqi
    aalnds