PDB entry 1aa3

View 1aa3 on RCSB PDB site
Description: c-terminal domain of the e. coli reca, nmr, minimized average structure
Deposited on 1997-01-22, released 1997-07-23
The last revision prior to the SCOP 1.57 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1aa3__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aa3_ (-)
  infygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrell
  lsn