PDB entry 1a48

View 1a48 on RCSB PDB site
Description: saicar synthase
Class: ATP binding protein
Keywords: ATP binding protein, crystal structure, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) synthase, purine biosynthesis
Deposited on 1998-02-12, released 1999-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylaminoimidazole-succinocarboxamide synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a48a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a48A (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
    lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
    rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
    skwsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a48A (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstdenispaqaaelvgedls
    rrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfwngas
    ykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskwsh