PDB entry 189l

View 189l on RCSB PDB site
Description: enhancement of protein stability by the combination of point mutations in t4 lysozyme is additive
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-05-09, released 1995-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • conflict (2)
      • conflict (37)
      • conflict (40)
      • conflict (81)
      • conflict (115)
      • conflict (130)
      • conflict (143)
    Domains in SCOPe 2.04: d189la_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >189lA (A:)
    mnlfemlrideglrlkiykdtegyytigighlltkspdlnvakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnpklkpvydsldavrrcalinmvfqmgetgvagftdslrm
    lqqkrwdeaaanlaksrwynqtpdrakrvittfrtgtwdayknl