PDB entry 2b5l

View 2b5l on RCSB PDB site
Description: Crystal Structure of DDB1 In Complex with Simian Virus 5 V Protein
Class: protein binding/viral protein
Keywords: DDB1, SV5-V, beta propeller, propeller cluster, zinc finger, PROTEIN BINDING/VIRAL PROTEIN COMPLEX
Deposited on 2005-09-28, released 2006-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.229
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: damage-specific DNA binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_001914 (0-1139)
    Domains in SCOPe 2.06: d2b5la1, d2b5la2, d2b5la3, d2b5la4
  • Chain 'B':
    Compound: damage-specific DNA binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_001914 (0-1139)
    Domains in SCOPe 2.06: d2b5lb1, d2b5lb2, d2b5lb3, d2b5lb4
  • Chain 'C':
    Compound: Nonstructural protein V
    Species: Simian virus 5 [TaxId:11207]
    Gene: P/V
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b5lc_
  • Chain 'D':
    Compound: Nonstructural protein V
    Species: Simian virus 5 [TaxId:11207]
    Gene: P/V
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b5ld_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b5lA (A:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfssstaphet
    sfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypee
    aepkqgrivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvr
    tecnhynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveil
    dddnflgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlget
    stptqgsvlfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhter
    ktepatgfidgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5lA (A:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfsstsfgeev
    evhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypeeaepkqg
    rivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvrtecnhy
    nnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveildddnfl
    gaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlgstptqgsv
    lfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhterktepatgf
    idgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b5lB (B:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfssstaphet
    sfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypee
    aepkqgrivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvr
    tecnhynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveil
    dddnflgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlget
    stptqgsvlfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhter
    ktepatgfidgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5lB (B:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfsstsfgeev
    evhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypeeaepkqg
    rivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvrtecnhy
    nnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveildddnfl
    gaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlgetstptqg
    svlfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhterktepat
    gfidgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b5lC (C:)
    mdptdlsfspdeinklietglntveyftsqqvtgtsslgkntippgvtglltnaaeakiq
    estnhqkgsvgggakpkkprpkiaivpaddktvpgkpipnpllgldstpstqtvldlsgk
    tlpsgsykgvklakfgkenlmtrfieeprenpiatsspidfkrgrdtggfhrreysigwv
    gdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5lC (C:)
    lietglntveyftsqqvtgtsslgkntippgvtglltnapkiaivpaddktvpgkpipnp
    llgldstpstqtvldlsgktlpsgsykgvklakfgkenlmtrfieeprenpdfkrgrdtg
    gfhrreysigwvgdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b5lD (D:)
    mdptdlsfspdeinklietglntveyftsqqvtgtsslgkntippgvtglltnaaeakiq
    estnhqkgsvgggakpkkprpkiaivpaddktvpgkpipnpllgldstpstqtvldlsgk
    tlpsgsykgvklakfgkenlmtrfieeprenpiatsspidfkrgrdtggfhrreysigwv
    gdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5lD (D:)
    klietglntveyftsqqvtgtsslgkntippgvtglltnarpkiaivpaddktvpgkpip
    npllgldstpstqtvldlsgktlpsgsykgvklakfgkenlmtrfieepreidfkrgrdt
    ggfhrreysigwvgdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt