Lineage for d1uu2a_ (1uu2 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705553Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 705561Species Thermotoga maritima [TaxId:2336] [102594] (5 PDB entries)
    TM1040
  8. 705574Domain d1uu2a_: 1uu2 A: [99997]

Details for d1uu2a_

PDB Entry: 1uu2 (more details), 2.8 Å

PDB Description: histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form)
PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOP Domain Sequences for d1uu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uu2a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]}
yetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdf
lsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripe
vnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyen
lavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifee
rtkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfreg
vritigkreendmilrelevfk

SCOP Domain Coordinates for d1uu2a_:

Click to download the PDB-style file with coordinates for d1uu2a_.
(The format of our PDB-style files is described here.)

Timeline for d1uu2a_: