PDB entry 1uu2

View 1uu2 on RCSB PDB site
Description: histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form)
Class: transferase
Keywords: histidine biosynthesis, transferase, aminotransferase, pyridoxal phosphate, complete proteome aminotransferase, histidine biosynthesis
Deposited on 2003-12-13, released 2004-03-18
The last revision prior to the SCOP 1.73 freeze date was dated 2004-05-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uu2a_
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uu2b_
  • Heterogens: PMP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uu2A (A:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uu2A (A:)
    yetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdf
    lsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripe
    vnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyen
    lavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifee
    rtkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfreg
    vritigkreendmilrelevfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uu2B (B:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uu2B (B:)
    ekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdflsk
    nnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripevnv
    gegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyenlav
    irtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifeertk
    fiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfregvri
    tigkreendmilrelevfk