| Class b: All beta proteins [48724] (178 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein Trypsin(ogen) [50515] (9 species) |
| Species Atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries) |
| Domain d1utja_: 1utj A: [99963] complexed with abn, ca |
PDB Entry: 1utj (more details), 1.83 Å
SCOPe Domain Sequences for d1utja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utja_ b.47.1.2 (A:) Trypsin(ogen) {Atlantic salmon (Salmo salar) [TaxId: 8030]}
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy
Timeline for d1utja_: