Lineage for d1ut8b2 (1ut8 B:20-185)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011866Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 1011867Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 1011923Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 1011951Protein T5 5'-exonuclease [53050] (1 species)
  7. 1011952Species Bacteriophage T5 [TaxId:10726] [53051] (4 PDB entries)
  8. 1011958Domain d1ut8b2: 1ut8 B:20-185 [99911]
    Other proteins in same PDB: d1ut8a1, d1ut8b1
    complexed with zn

Details for d1ut8b2

PDB Entry: 1ut8 (more details), 2.75 Å

PDB Description: divalent metal ions (zinc) bound to t5 5'-exonuclease
PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d1ut8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut8b2 c.120.1.2 (B:20-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn

SCOPe Domain Coordinates for d1ut8b2:

Click to download the PDB-style file with coordinates for d1ut8b2.
(The format of our PDB-style files is described here.)

Timeline for d1ut8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ut8b1