Lineage for d1uswa_ (1usw A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003289Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. 1003294Protein Feruloyl esterase A [102631] (1 species)
    Triacylglycerol lipase homologue
  7. 1003295Species Aspergillus niger [TaxId:5061] [102632] (5 PDB entries)
    Uniprot O42807 23-281
  8. 1003304Domain d1uswa_: 1usw A: [99895]
    complexed with so4

Details for d1uswa_

PDB Entry: 1usw (more details), 2.5 Å

PDB Description: crystal structure of ferulic acid esterase from aspergillus niger
PDB Compounds: (A:) feruloyl esterase a

SCOPe Domain Sequences for d1uswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uswa_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppadegyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactw

SCOPe Domain Coordinates for d1uswa_:

Click to download the PDB-style file with coordinates for d1uswa_.
(The format of our PDB-style files is described here.)

Timeline for d1uswa_: