Lineage for d1uska_ (1usk A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624508Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1624656Protein Leucine-binding protein [53843] (1 species)
  7. 1624657Species Escherichia coli [TaxId:562] [53844] (4 PDB entries)
  8. 1624661Domain d1uska_: 1usk A: [99867]
    complexed with leu

Details for d1uska_

PDB Entry: 1usk (more details), 2 Å

PDB Description: l-leucine-binding protein with leucine bound
PDB Compounds: (A:) leucine-specific binding protein

SCOPe Domain Sequences for d1uska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uska_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]}
ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak

SCOPe Domain Coordinates for d1uska_:

Click to download the PDB-style file with coordinates for d1uska_.
(The format of our PDB-style files is described here.)

Timeline for d1uska_: