SCOP 1.69: Domain d1usfb_: 1usf B:

Lineage for d1usfb_ (1usf B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (2 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (4 proteins)
   different dimerization mode than in the PNP-oxidase like family

6. Protein Putative styrene monooxygenase small component [101796] (1 species)

7. Species Thermus thermophilus [TaxId:274] [101797] (2 PDB entries)

8. Domain d1usfb_: 1usf B: [99863]

Details for d1usfb_

PDB Entry: 1usf, 1.3 Å

PDB Description: putative styrene monooxygenase small component with bound nadp+

SCOP Domain Sequences for d1usfb_:

Sequence; same for both SEQRES and ATOM records:

>d1usfb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

Timeline for d1usfb_:

• d1usfb_ first appeared in SCOP 1.67
  
• d1usfb_ appears in SCOP 1.71
  
• d1usfb_ appears in the current release, SCOPe 2.08