Lineage for d1usfa_ (1usf A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464994Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
    barrel; n=6, S=10; greek-key
  4. 464995Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 465018Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (4 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 465046Protein Putative styrene monooxygenase small component [101796] (1 species)
  7. 465047Species Thermus thermophilus [TaxId:274] [101797] (2 PDB entries)
  8. 465050Domain d1usfa_: 1usf A: [99862]

Details for d1usfa_

PDB Entry: 1usf (more details), 1.3 Å

PDB Description: putative styrene monooxygenase small component with bound nadp+

SCOP Domain Sequences for d1usfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usfa_ b.45.1.2 (A:) Putative styrene monooxygenase small component {Thermus thermophilus}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

SCOP Domain Coordinates for d1usfa_:

Click to download the PDB-style file with coordinates for d1usfa_.
(The format of our PDB-style files is described here.)

Timeline for d1usfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1usfb_