Lineage for d1urha2 (1urh A:149-268)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584429Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 584430Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) (S)
    Pfam F00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 584447Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (3 proteins)
    duplication: consists of two domains of this fold
  6. 584448Protein 3-mercaptopyruvate sulfurtransferase [102427] (2 species)
  7. 584449Species Escherichia coli [TaxId:562] [102429] (1 PDB entry)
  8. 584451Domain d1urha2: 1urh A:149-268 [99830]

Details for d1urha2

PDB Entry: 1urh (more details), 2.8 Å

PDB Description: the "rhodanese" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli

SCOP Domain Sequences for d1urha2:

Sequence, based on SEQRES records: (download)

>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli}
npeavvkvtdvllashentaqiidarpaarfnaevdeprpglrrghipgalnvpwtelvr
egelkttdeldaiffgrgvsydkpiivscgsgvtaavvllalatldvpnvklydgawsew

Sequence, based on observed residues (ATOM records): (download)

>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli}
npeavvkvtdvllashentaqiidarpaarfnaevdelrrghipgalnvpwtelvregel
kttdeldaiffgrgvsydkpiivscgsgvtaavvllalatldvpnvklydgawsew

SCOP Domain Coordinates for d1urha2:

Click to download the PDB-style file with coordinates for d1urha2.
(The format of our PDB-style files is described here.)

Timeline for d1urha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1urha1