![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) ![]() the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (3 proteins) duplication: consists of two domains of this fold |
![]() | Protein 3-mercaptopyruvate sulfurtransferase [102427] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [102429] (1 PDB entry) |
![]() | Domain d1urha2: 1urh A:149-268 [99830] |
PDB Entry: 1urh (more details), 2.8 Å
SCOP Domain Sequences for d1urha2:
Sequence, based on SEQRES records: (download)
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli} npeavvkvtdvllashentaqiidarpaarfnaevdeprpglrrghipgalnvpwtelvr egelkttdeldaiffgrgvsydkpiivscgsgvtaavvllalatldvpnvklydgawsew
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli} npeavvkvtdvllashentaqiidarpaarfnaevdelrrghipgalnvpwtelvregel kttdeldaiffgrgvsydkpiivscgsgvtaavvllalatldvpnvklydgawsew
Timeline for d1urha2: